PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco008510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WRKY
Protein Properties Length: 163aa    MW: 18254.6 Da    PI: 7.9779
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco008510.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.5e-331067259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 +Dgy+WrKYGqK vk+s++prsYYrCt ++C vkk+vers+edp++v++tYeg+H h+
  Aco008510.1 10 EDGYRWRKYGQKAVKNSPYPRSYYRCTNSKCAVKKRVERSSEDPSIVITTYEGQHCHH 67
                 8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-32268IPR003657WRKY domain
SuperFamilySSF1182901.44E-28367IPR003657WRKY domain
PROSITE profilePS5081129.907469IPR003657WRKY domain
SMARTSM007744.0E-38968IPR003657WRKY domain
PfamPF031063.8E-261067IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MTKSEIDHLE DGYRWRKYGQ KAVKNSPYPR SYYRCTNSKC AVKKRVERSS EDPSIVITTY  60
EGQHCHHTVT FPRCTPGIVH NTHNSVLTEQ IAYPSQAQLY LPTSTLQLYQ NSNPPPPLSE  120
AGREMVGLLR EEVQSSPLER TAPIPVDEGL LGDMVPPGMR NG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-27166974Probable WRKY transcription factor 4
2lex_A1e-27166974Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6611264e-87KM661126.1 Ananas bracteatus clone 42020 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008776994.12e-64PREDICTED: probable WRKY transcription factor 57 isoform X2
RefseqXP_008776993.13e-64PREDICTED: probable WRKY transcription factor 57 isoform X1
SwissprotQ9C9834e-51WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLA0A140H8R47e-58A0A140H8R4_MANES; WRKY transcription factor 60
TrEMBLC9DI005e-58C9DI00_9R
STRINGPOPTR_0008s09360.13e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-52WRKY DNA-binding protein 57